PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00548g00014.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family bZIP
Protein Properties Length: 183aa    MW: 21443 Da    PI: 10.8496
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00548g00014.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.67.3e-1078130557
                               CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                    bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                               ++ rr+ +NRe+ArrsR RK++ +e+L++ v   +  N++L +++  ++ +v+
  Peaxi162Scf00548g00014.1  78 RKKRRMVSNRESARRSRMRKQQHLENLRNQVNRSKLGNRELMNRVRFMTHQVQ 130
                               68899***************************999999999887776666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003389.8E-1374138IPR004827Basic-leucine zipper domain
PfamPF077161.0E-476123IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.81876139IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1709.7E-1078130No hitNo description
SuperFamilySSF579591.45E-1078129No hitNo description
CDDcd147024.08E-1279128No hitNo description
PROSITE patternPS0003608196IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MRRKTKDQEP VCSPKQSTPP PEPVLSNSGS GSDDSKPDSF HSSSGSDEPP DRNNNNYINS  60
NCGSKRPRMT PNRDVDERKK RRMVSNRESA RRSRMRKQQH LENLRNQVNR SKLGNRELMN  120
RVRFMTHQVQ LVECDNERLR TDSAVLRQRL EDIRQILIAR QLEQQFSYHS AWACNNMELQ  180
RPL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19097RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016560923.14e-76PREDICTED: light-inducible protein CPRF2-like
TrEMBLM1BXK23e-69M1BXK2_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000552149e-69(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28202251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22850.29e-25basic leucine-zipper 6